Bacterial PB000185.00.0 protein

Artikelnummer: BYT-ORB419024
Artikelname: Bacterial PB000185.00.0 protein
Artikelnummer: BYT-ORB419024
Hersteller Artikelnummer: orb419024
Alternativnummer: BYT-ORB419024-1,BYT-ORB419024-100,BYT-ORB419024-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: PB000185.00.0, L-lactate dehydrogenase, EC 1.1.1.27
This Bacterial PB000185.00.0 protein spans the amino acid sequence from region 1-316aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 39.4 kDa
UniProt: Q7SI97
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Plasmodium berghei (strain Anka)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLR
Anwendungsbeschreibung: Biological Origin: Plasmodium berghei (strain Anka). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-316aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Plasmodium berghei (strain Anka) PB000185.00.0.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Plasmodium berghei (strain Anka) PB000185.00.0.