Bacterial PLY protein

Produktübersicht

• Artikelname: Bacterial PLY protein
• Artikelnummer: BYT-ORB419028
• Hersteller Artikelnummer: orb419028
• Alternativnummer: BYT-ORB419028-1,BYT-ORB419028-100,BYT-ORB419028-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Thiol-activated cytolysin

Produktbeschreibung

This Bacterial PLY protein spans the amino acid sequence from region 2-471aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 72.8 kDa
• UniProt: Q04IN8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVNNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2-471aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) ply.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) ply.