Bacterial PLY protein

Artikelnummer: BYT-ORB419028
Artikelname: Bacterial PLY protein
Artikelnummer: BYT-ORB419028
Hersteller Artikelnummer: orb419028
Alternativnummer: BYT-ORB419028-1,BYT-ORB419028-100,BYT-ORB419028-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Thiol-activated cytolysin
This Bacterial PLY protein spans the amino acid sequence from region 2-471aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 72.8 kDa
UniProt: Q04IN8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ANKAVNDFILAMNYDKKKLLTHQGESIENRFIKEGNQLPDEFVVIERKKRSLSTNTSDISVTATNDSRLYPGALLVVDETLLENNPTLLAVDRAPMTYSIDLPGLASSDSFLQVEDPSNSSVRGAVNDLLAKWHQDYGQVNNVPARMQYEKITAHSMEQLKVKFGSDFEKTGNSLDIDFNSVHSGEKQIQIVNFKQIYYTVSVDAVKNPGDVFQDTVTVEDLKQRGISAERPLVYISSVAYGRQVYLKLETTSKS
Anwendungsbeschreibung: Biological Origin: Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2-471aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) ply.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) ply.