Human CLU protein

Produktübersicht

• Artikelname: Human CLU protein
• Artikelnummer: BYT-ORB419134
• Hersteller Artikelnummer: orb419134
• Alternativnummer: BYT-ORB419134-1,BYT-ORB419134-100,BYT-ORB419134-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Aging-associated gene 4 protein Apolipoprotein J

Produktbeschreibung

This Human CLU protein spans the amino acid sequence from region 23-449aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 70.1 kDa
• UniProt: P10909
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIRE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 23-449aaSequence Info: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLU.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLU.