Bacterial alpha-amylase inhibitor HOE-467A protein
Artikelnummer:
BYT-ORB419136
- Bilder (3)
| Artikelname: | Bacterial alpha-amylase inhibitor HOE-467A protein |
| Artikelnummer: | BYT-ORB419136 |
| Hersteller Artikelnummer: | orb419136 |
| Alternativnummer: | BYT-ORB419136-20,BYT-ORB419136-100,BYT-ORB419136-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Tendamistat |
| This Bacterial alpha-amylase inhibitor HOE-467A protein spans the amino acid sequence from region 31-104aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 28 kDa |
| UniProt: | P01092 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Streptomyces tendae |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | DTTVSEPAPSCVTLYQSWRYSQADNGCAQTVTVKVVYEDDTEGLCYAVAPGQITTVGDGYIGSHGHARYLARCL |
| Anwendungsbeschreibung: | Biological Origin: Streptomyces tendae. Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 31-104aaSequence Info: Extracellular Domain |



