E. coli ELTA protein

Artikelnummer: BYT-ORB419220
Artikelname: E. coli ELTA protein
Artikelnummer: BYT-ORB419220
Hersteller Artikelnummer: orb419220
Alternativnummer: BYT-ORB419220-1,BYT-ORB419220-100,BYT-ORB419220-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: LT-A, porcine LTP-A
This E. coli ELTA protein spans the amino acid sequence from region 19-258aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 45.3 kDa
UniProt: P06717
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQTGFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDVLGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYYRNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Anwendungsbeschreibung: Biological Origin: Escherichia coli. Application Notes: Tag Info: N-terminal 6xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 19-258aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colieltA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colieltA.