Bacterial APT protein

Produktübersicht

• Artikelname: Bacterial APT protein
• Artikelnummer: BYT-ORB419282
• Hersteller Artikelnummer: orb419282
• Alternativnummer: BYT-ORB419282-1,BYT-ORB419282-100,BYT-ORB419282-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: apt, SPy_0927, M5005_Spy0728Adenine phosphoribosyltransferase, APRT, EC 2.4.2.7

Produktbeschreibung

This Bacterial APT protein spans the amino acid sequence from region 1-172aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 22.7 kDa
• UniProt: P63546
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Streptococcus pyogenes serotype M1
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Streptococcus pyogenes serotype M1. Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-172aaSequence Info: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M1apt.

Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M1apt.