Viral Glycoprotein protein

Produktübersicht

• Artikelname: Viral Glycoprotein protein
• Artikelnummer: BYT-ORB419329
• Hersteller Artikelnummer: orb419329
• Alternativnummer: BYT-ORB419329-1,BYT-ORB419329-100,BYT-ORB419329-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: GGlycoprotein

Produktbeschreibung

This Viral Glycoprotein protein spans the amino acid sequence from region 20-459aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 69.7 kDa
• UniProt: O92284
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Rabies virus (strain CVS-11) (RABV)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTTKESLIIISPSVTDLDPYDKSLHSRVFPGGKCSGITVSSTYCSTNHDYTIWMPENPRPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Rabies virus (strain CVS-11) (RABV). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 20-459aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rabies virus (strain CVS-11) (RABV) G.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rabies virus (strain CVS-11) (RABV) G.