Human Protein E7 protein

Produktübersicht

• Artikelname: Human Protein E7 protein
• Artikelnummer: BYT-ORB419331
• Hersteller Artikelnummer: orb419331
• Alternativnummer: BYT-ORB419331-1,BYT-ORB419331-100,BYT-ORB419331-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: E7, Protein E7

Produktbeschreibung

This Human Protein E7 protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 38 kDa
• UniProt: P03129
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human papillomavirus type 16
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Human papillomavirus type 16. Application Notes: Tag Info: N-terminal GST-taggedExpression Region: 1-98aaSequence Info: Partial of NM_000583.3

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human papillomavirus type 16E7.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human papillomavirus type 16E7.