Human Protease protein

Artikelnummer: BYT-ORB419333
Artikelname: Human Protease protein
Artikelnummer: BYT-ORB419333
Hersteller Artikelnummer: orb419333
Alternativnummer: BYT-ORB419333-1,BYT-ORB419333-100,BYT-ORB419333-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Adenain Adenovirus protease
This Human Protease protein spans the amino acid sequence from region 1-204aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 28.1 kDa
UniProt: P03253
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGSSEQELKAIVKDLGCGPYFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPHSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASSPDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCHLKNM
Anwendungsbeschreibung: Biological Origin: Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-204aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) L3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) L3.