Viral Spike glycoprotein protein

Produktübersicht

• Artikelname: Viral Spike glycoprotein protein
• Artikelnummer: BYT-ORB419343
• Hersteller Artikelnummer: orb419343
• Alternativnummer: BYT-ORB419343-1,BYT-ORB419343-100,BYT-ORB419343-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: E2 Peplomer protein

Produktbeschreibung

This Viral Spike glycoprotein protein spans the amino acid sequence from region 326-540aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 27.2 kDa
• UniProt: P15777
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Bovine coronavirus (strain Mebus) (BCoV) (BCV)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Bovine coronavirus (strain Mebus) (BCoV) (BCV). Application Notes: Tag Info: N-terminal 10xHis-taggedExpression Region: 326-540aaSequence Info: Extracellular Domain

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bovine coronavirus (strain Mebus) (BCoV) (BCV) S.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bovine coronavirus (strain Mebus) (BCoV) (BCV) S.