Viral Polymerase acidic protein

Produktübersicht

• Artikelname: Viral Polymerase acidic protein
• Artikelnummer: BYT-ORB419359
• Hersteller Artikelnummer: orb419359
• Alternativnummer: BYT-ORB419359-1,BYT-ORB419359-100,BYT-ORB419359-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: RNA-directed RNA polymerase subunit P2

Produktbeschreibung

This Viral Polymerase acidic protein spans the amino acid sequence from region 124-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 18.6 kDa
• UniProt: Q9IQ47
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Influenza A virus (strain A/x-31 H3N2)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Influenza A virus (strain A/x-31 H3N2). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 124-247aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/x-31 H3N2) PA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/x-31 H3N2) PA.