Fish GH Protein

Produktübersicht

• Artikelname: Fish GH Protein
• Artikelnummer: BYT-ORB425714
• Hersteller Artikelnummer: orb425714
• Alternativnummer: BYT-ORB425714-1, BYT-ORB425714-10, BYT-ORB425714-2
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.

Produktbeschreibung

Recombinant of fish GH protein

Produkteigenschaften

• Puffer: The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3. Adjusted to pH-8.
• Reinheit: Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) in 0.4% NaHCO3 or water adjusted to pH 8-9, not less than 100µg/ml and not more than 3mg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar. Biological Activity: Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH. Application Notes: Cytokines And Growth Factors