Human LELP1 protein

Artikelnummer: BYT-ORB54428
Artikelname: Human LELP1 protein
Artikelnummer: BYT-ORB54428
Hersteller Artikelnummer: orb54428
Alternativnummer: BYT-ORB54428-20,BYT-ORB54428-100,BYT-ORB54428-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: Novel small proline-rich protein
Recombinant human LELP1 protein
Molekulargewicht: 37.7 kDa
UniProt: Q5T871
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE
Anwendungsbeschreibung: N-terminal GST-tagged: N-terminal GST-tagged1-176AA: 1-98AAFull Length : Full Length