Human MEMO1 protein

Artikelnummer: BYT-ORB54546
Artikelname: Human MEMO1 protein
Artikelnummer: BYT-ORB54546
Hersteller Artikelnummer: orb54546
Alternativnummer: BYT-ORB54546-20,BYT-ORB54546-100,BYT-ORB54546-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: C21orf19-like protein Hepatitis C virus NS5A-transactivated protein 7
This Human MEMO1 protein spans the amino acid sequence from region 1-297aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 60.7 kDa
UniProt: Q9Y316
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal GST-tagged: N-terminal GST-tagged1-296AA: 1-297AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.