Bacterial laaA protein

Artikelnummer: BYT-ORB54661
Artikelname: Bacterial laaA protein
Artikelnummer: BYT-ORB54661
Hersteller Artikelnummer: orb54661
Alternativnummer: BYT-ORB54661-1,BYT-ORB54661-100,BYT-ORB54661-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: laaAL-amino acid amidase, EC 3.5.1.101
This Bacterial laaA protein spans the amino acid sequence from region 1-310aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 54.5 kDa
UniProt: Q76KX0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Pseudomonas azotoformans
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEFIEKIREGYAAFGAYQTWYRVTGDLSSGRTPLVVIHGGPGCTHDYVDAFKDVAASGHAVIHYDQLGNGRSTHLPDKDPSFWTVGLFLEELNNLLDHLQISDNYAILGQSWGGMLGSEHAILQPKGLRAFIPANSPTCMRTWVSEANRLRKLLPEGVHETLLKHETAGTYQDPEYLAASRVFYDHHVCRVIPWPEEVARTFAAVDADPTVYHAMSGPTEFHVIGSLKDWKSTGRLSAINVPTLVISGRHDEATP
Anwendungsbeschreibung: Biological Origin: Pseudomonas azotoformans. Application Notes: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged1-353AA: 1-310AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Pseudomonas azotoformanslaaA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Pseudomonas azotoformanslaaA.