Mouse Efemp1 protein

Artikelnummer: BYT-ORB54758
Artikelname: Mouse Efemp1 protein
Artikelnummer: BYT-ORB54758
Hersteller Artikelnummer: orb54758
Alternativnummer: BYT-ORB54758-1,BYT-ORB54758-100,BYT-ORB54758-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Fibulin-3
This Mouse Efemp1 protein spans the amino acid sequence from region 18-493aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 57.5 kDa
UniProt: Q8BPB5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QYTEETITYTQCTDGYEWDPIRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEHPQQETPAAEASSGATTGTVAARSMATSGVVPGGGFMASATAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTSGTHNCRTDQVCINLRGSFTCQCLPGYQKRGEQCVDIDECTVPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNIL
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 10xHis-tagged and C-terminal Myc-tagged: N-terminal 6xHis-tagged1-518AA: 18-493AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
SDS-PAGE analysis of Mouse Efemp1 protein.