HTR2B Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: HTR2B Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB573678
• Hersteller Artikelnummer: orb573678
• Alternativnummer: BYT-ORB573678-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IF, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR2B
• Konjugation: Unconjugated
• Alternative Synonym: 5-HT2B, 5-HT-2B, 5-HT(2B)

Produktbeschreibung

Rabbit polyclonal antibody to HTR2B

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 54 kDa
• NCBI: 000858
• UniProt: P41595
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
• Target-Kategorie: HTR2B

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.4 ug/ml of the antibody was used in this experiment. In addition to the 54 kDa canonical protein, isoforms of 51 kDa and 50 kDa also contain this peptide. Proteins may be lipidated and/or glycosylated as well.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Immunofluorescence: 1.3 ug/ml.

WB Suggested Anti-HTR2B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, HTR2B is supported by BioGPS gene expression data to be expressed in 721_B.