SOX2 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SOX2 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB573909
• Hersteller Artikelnummer: orb573909
• Alternativnummer: BYT-ORB573909-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Frog, Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOX2
• Konjugation: Unconjugated
• Alternative Synonym: ANOP3, MCOPS3

Produktbeschreibung

Rabbit polyclonal antibody to SOX2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 34kDa
• NCBI: 003097
• UniProt: P48431
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV
• Target-Kategorie: SOX2

Bilder

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Human kidney

Human Spleen

Application:IHC Species+tissue/cell type: Xenopus laevis cornea epithellium Primary antibody dilution: 1:300 Secondary antibody:Goat anti-rabbit -rhodamine Secondary antibody dilution: 1:300.

Sample Type: Lane 1: 20 ug U87 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2000.

WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:500, Positive Control: OVCAR-3 cell lysate, There is BioGPS gene expression data showing that SOX2 is expressed in OVCAR3.