Pdx1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574003
| Artikelname: |
Pdx1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574003 |
| Hersteller Artikelnummer: |
orb574003 |
| Alternativnummer: |
BYT-ORB574003-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
Ip, IPF, IDX-, Ipf1, Mody, STF-, pdx-, IDX-1, IPF-1, Mody4, STF-1, pdx-1 |
| Rabbit polyclonal antibody to Pdx1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
31kDa |
| NCBI: |
032840 |
| UniProt: |
P52946 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LYMGRQPPPPPPPQFTSSLGSLEQGSPPDISPYEVPPLASDDPAGAHLHH |
| Target-Kategorie: |
Pdx1 |
![]()
|
WB Suggested Anti-Pdx1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Pancreas. |
