Mafg Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574017
| Artikelname: |
Mafg Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574017 |
| Hersteller Artikelnummer: |
orb574017 |
| Alternativnummer: |
BYT-ORB574017-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mafg |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
AA545192, C630022N07Rik |
| Rabbit polyclonal antibody to Mafg |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
18kDa |
| NCBI: |
034886 |
| UniProt: |
O54790 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL |
| Target-Kategorie: |
Mafg |
![]()
|
WB Suggested Anti-Mafg Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Muscle. |
