MYBL1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574022
Artikelname: MYBL1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574022
Hersteller Artikelnummer: orb574022
Alternativnummer: BYT-ORB574022-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MYBL1
Konjugation: Unconjugated
Alternative Synonym: AMYB, A-MYB
Rabbit polyclonal antibody to MYBL1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 82kDa
NCBI: 001073885
UniProt: P10243
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: AFIQQPFIDEDPDKEKKIKELEMLLMSAENEVRRKRIPSQPGSFSSWSGS
Target-Kategorie: MYBL1
WB Suggested Anti-MYBL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Muscle.