NAB2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574024
Artikelname: NAB2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574024
Hersteller Artikelnummer: orb574024
Alternativnummer: BYT-ORB574024-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NAB2
Konjugation: Unconjugated
Alternative Synonym: MADER
Rabbit polyclonal antibody to NAB2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 56kDa
NCBI: 005958
UniProt: Q15742
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSY
Target-Kategorie: NAB2
Sample Tissue: Human Fetal Thymus, Antibody dilution: 1 ug/ml.