NKX2-2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574028
Artikelname: NKX2-2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574028
Hersteller Artikelnummer: orb574028
Alternativnummer: BYT-ORB574028-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NKX2-2
Konjugation: Unconjugated
Alternative Synonym: NKX2B, NKX2.2
Rabbit polyclonal antibody to NKX2-2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 30kDa
NCBI: 002500
UniProt: O95096
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKA
Target-Kategorie: NKX2-2
Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 1.0 ug/ml.