AXIN2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574043
Artikelname: AXIN2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574043
Hersteller Artikelnummer: orb574043
Alternativnummer: BYT-ORB574043-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human AXIN2
Konjugation: Unconjugated
Alternative Synonym: AXIL, ODCRCS
Rabbit polyclonal antibody to AXIN2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 92kDa
NCBI: 004646
UniProt: Q9Y2T1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: FRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSI
Target-Kategorie: AXIN2
Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 1.0 ug/ml.