FOXO6 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574050
Artikelname: FOXO6 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574050
Hersteller Artikelnummer: orb574050
Alternativnummer: BYT-ORB574050-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOXO6
Konjugation: Unconjugated
Rabbit polyclonal antibody to FOXO6
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 61kDa
UniProt: A8MYZ6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LSYADLITKAIESAPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNS
Target-Kategorie: FOXO6
Sample Type: Colorectal Tumor lysates, Antibody dilution: 1.0 ug/ml.