FOXO4 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574051
Artikelname: FOXO4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574051
Hersteller Artikelnummer: orb574051
Alternativnummer: BYT-ORB574051-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FOXO4
Konjugation: Unconjugated
Alternative Synonym: AFX, AFX1, MLLT7
Rabbit polyclonal antibody to FOXO4
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 54kDa
NCBI: 005929
UniProt: P98177
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TPVLTPPTEAASQDRMPQDLDLDMYMENLECDMDNIISDLMDEGEGLDFN
Target-Kategorie: FOXO4
WB Suggested Anti-FOXO4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:7812500, Positive Control: Hela cell lysate.