PIK3CB Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574052
Artikelname: PIK3CB Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574052
Hersteller Artikelnummer: orb574052
Alternativnummer: BYT-ORB574052-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PIK3CB
Konjugation: Unconjugated
Alternative Synonym: PI3K, PIK3C1, P110BETA, PI3KBETA
Rabbit polyclonal antibody to PIK3CB
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 123kDa
NCBI: 006210
UniProt: Q24JU2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
Target-Kategorie: PIK3CB
WB Suggested Anti-PIK3CB Antibody Titration: 5 ug/ml, Positive Control: Human brain.