Pik3r1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574054
| Artikelname: |
Pik3r1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574054 |
| Hersteller Artikelnummer: |
orb574054 |
| Alternativnummer: |
BYT-ORB574054-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
PI, p50, p55, p85, PI3K, p50alpha, p55alpha, p85alpha |
| Rabbit polyclonal antibody to Pik3r1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
53kDa |
| NCBI: |
001020126 |
| UniProt: |
Q80UI5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: HEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQ |
| Target-Kategorie: |
Pik3r1 |
![]()
|
WB Suggested Anti-Pik3r1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Brain. |
