PRMT3 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574062
Artikelname: PRMT3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574062
Hersteller Artikelnummer: orb574062
Alternativnummer: BYT-ORB574062-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRMT3
Konjugation: Unconjugated
Alternative Synonym: HRMT1L3
Rabbit polyclonal antibody to PRMT3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 60kDa
NCBI: 005779
UniProt: O60678
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILS
Target-Kategorie: PRMT3
WB Suggested Anti-PRMT3 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.