ZNF526 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574065
Artikelname: ZNF526 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574065
Hersteller Artikelnummer: orb574065
Alternativnummer: BYT-ORB574065-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF526
Konjugation: Unconjugated
Alternative Synonym: DKFZp762O059, KIAA1951, MGC4267
Rabbit polyclonal antibody to ZNF526
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 74kDa
NCBI: 597701
UniProt: Q8TF50
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PPTPLPPPSPPSEVKMEPYECPECSTLCATPEEFLEHQGTHFDSLEKEER
Target-Kategorie: ZNF526
WB Suggested Anti-ZNF526 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: MCF7 cell lysate.