ZNF543 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574069
Artikelname: ZNF543 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574069
Hersteller Artikelnummer: orb574069
Alternativnummer: BYT-ORB574069-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF543
Konjugation: Unconjugated
Rabbit polyclonal antibody to ZNF543
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 68kDa
NCBI: 998763
UniProt: Q495V0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SSHLTRHQQIHTGEKPYECIQCGKAFCRSANLIRHSIIHTGEKPYECSEC
Target-Kategorie: ZNF543
WB Suggested Anti-ZNF543 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.