ZNF787 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574070
Artikelname: ZNF787 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574070
Hersteller Artikelnummer: orb574070
Alternativnummer: BYT-ORB574070-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF787
Konjugation: Unconjugated
Alternative Synonym: TIP20
Rabbit polyclonal antibody to ZNF787
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 40kDa
NCBI: 001002836
UniProt: Q6DD87
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: CPRCGRGFSQPKSLARHLRLHPELSGPGVAAKVLAASVRRAKGPEEAVAA
Target-Kategorie: ZNF787
WB Suggested Anti-ZNF787 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.