RAX Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574073
Artikelname: RAX Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574073
Hersteller Artikelnummer: orb574073
Alternativnummer: BYT-ORB574073-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAX
Konjugation: Unconjugated
Alternative Synonym: RX, MCOP3
Rabbit polyclonal antibody to RAX
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 37kDa
NCBI: 038463
UniProt: Q9Y2V3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EYEAPRPYCPKEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTF
Target-Kategorie: RAX
WB Suggested Anti-RAX Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.