SOX30 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574093
| Artikelname: |
SOX30 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574093 |
| Hersteller Artikelnummer: |
orb574093 |
| Alternativnummer: |
BYT-ORB574093-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SOX30 |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to SOX30 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
82kDa |
| NCBI: |
848511 |
| UniProt: |
O94993 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: PAANNAEISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREEFPGWVYQPR |
| Target-Kategorie: |
SOX30 |
![]()
|
WB Suggested Anti-SOX30 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. |
