ZNF449 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574103
Artikelname: ZNF449 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574103
Hersteller Artikelnummer: orb574103
Alternativnummer: BYT-ORB574103-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF449
Konjugation: Unconjugated
Alternative Synonym: ZSCAN19
Rabbit polyclonal antibody to ZNF449
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 60kDa
NCBI: 689908
UniProt: Q6P9G9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVI
Target-Kategorie: ZNF449
WB Suggested Anti-ZNF449 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.