Tank Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574117
Artikelname: Tank Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574117
Hersteller Artikelnummer: orb574117
Alternativnummer: BYT-ORB574117-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Rabbit polyclonal antibody to Tank
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 45kDa
NCBI: 665731
UniProt: Q8VDA2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKQTENYEQRIREQQEQLS
Target-Kategorie: Tank
Antibody dilution: 1.0 ug/ml, Sample Type: Rat Stomach.