KIN Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574123
| Artikelname: |
KIN Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574123 |
| Hersteller Artikelnummer: |
orb574123 |
| Alternativnummer: |
BYT-ORB574123-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human KIN |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
BTCD, Rts2, KIN17 |
| Rabbit polyclonal antibody to KIN |
| Klonalität: |
Polyclonal |
| Konzentration: |
1.0 mg/ml |
| Molekulargewicht: |
45kDa |
| NCBI: |
036443 |
| UniProt: |
O60870 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: EEKTAKFIEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSS |
| Target-Kategorie: |
KIN |
![]()
|
WB Suggested Anti-KIN Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate. |
