Aes Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574136
| Artikelname: |
Aes Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574136 |
| Hersteller Artikelnummer: |
orb574136 |
| Alternativnummer: |
BYT-ORB574136-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Aes |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
A, Gr, Aes, Grg, Esp1, Grg5, Grg-5, AL024115 |
| Rabbit polyclonal antibody to Aes |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
22kDa |
| NCBI: |
034477 |
| UniProt: |
P63002 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK |
| Target-Kategorie: |
Aes |
![]()
|
WB Suggested Anti-Aes Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Stomach. |
