OTX1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574182
| Artikelname: |
OTX1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574182 |
| Hersteller Artikelnummer: |
orb574182 |
| Alternativnummer: |
BYT-ORB574182-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human OTX1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
FLJ38361, MGC15736 |
| Rabbit polyclonal antibody to OTX1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
37kDa |
| NCBI: |
055377 |
| UniProt: |
P32242 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: ISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSY |
| Target-Kategorie: |
OTX1 |
![]()
|
WB Suggested Anti-OTX1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. |
