RBL1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574234
Artikelname: RBL1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574234
Hersteller Artikelnummer: orb574234
Alternativnummer: BYT-ORB574234-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBL1
Konjugation: Unconjugated
Alternative Synonym: PRB1, p107, CP107
Rabbit polyclonal antibody to RBL1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 121kDa
NCBI: 002886
UniProt: P28749
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: NTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHS
Target-Kategorie: RBL1
WB Suggested Anti-RBL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.