NR5A2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574252
| Artikelname: |
NR5A2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574252 |
| Hersteller Artikelnummer: |
orb574252 |
| Alternativnummer: |
BYT-ORB574252-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human NR5A2 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
B1F, CPF, FTF, B1F2, LRH1, LRH-1, FTZ-F1, hB1F-2, FTZ-F1beta |
| Rabbit polyclonal antibody to NR5A2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
36kDa |
| NCBI: |
03248 |
| UniProt: |
O60587 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LPPTDYDRSPFVTSPISMTMLHGSLQGYQTYGHFPSRAIKSEYPDPYTSS |
| Target-Kategorie: |
NR5A2 |
![]()
|
WB Suggested Anti-NR5A2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. |
