RACGAP1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: RACGAP1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574282
• Hersteller Artikelnummer: orb574282
• Alternativnummer: BYT-ORB574282-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RACGAP1
• Konjugation: Unconjugated
• Alternative Synonym: CYK4, ID-GAP, HsCYK-4, MgcRacGAP

Produktbeschreibung

Rabbit polyclonal antibody to RACGAP1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 71kDa
• NCBI: 037409
• UniProt: Q9H0H5
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: KREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGG
• Target-Kategorie: RACGAP1

Bilder

WB Suggested Anti-RACGAP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: ACHN cell lysate, RACGAP1 is supported by BioGPS gene expression data to be expressed in ACHN.