TFCP2L1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574287
Artikelname: TFCP2L1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574287
Hersteller Artikelnummer: orb574287
Alternativnummer: BYT-ORB574287-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFCP2L1
Konjugation: Unconjugated
Alternative Synonym: LBP9, CRTR1, LBP-9
Rabbit polyclonal antibody to TFCP2L1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 55kDa
NCBI: 055368
UniProt: Q9NZI6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: HGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTD
Target-Kategorie: TFCP2L1
WB Suggested Anti-TFCP2L1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.