Hnf4g Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574303
| Artikelname: |
Hnf4g Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574303 |
| Hersteller Artikelnummer: |
orb574303 |
| Alternativnummer: |
BYT-ORB574303-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of MOUSE Hnf4g |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
NR, NR2A2 |
| Rabbit polyclonal antibody to Hnf4g |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
44kDa |
| UniProt: |
Q9WUU6 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: TRRSTYEGSNIPSINTLAQAEVRSCQISVPSPSSSTDINIKKIASISDVC |
| Target-Kategorie: |
Hnf4g |
![]()
|
Sample Type: Mouse Stomach lysates, Antibody dilution: 1.0 ug/ml. |
