FOXN2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574316
| Artikelname: |
FOXN2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574316 |
| Hersteller Artikelnummer: |
orb574316 |
| Alternativnummer: |
BYT-ORB574316-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
HTLF |
| Rabbit polyclonal antibody to FOXN2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
47kDa |
| NCBI: |
002149 |
| UniProt: |
P32314 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMML |
| Target-Kategorie: |
FOXN2 |
![]()
|
WB Suggested Anti-FOXN2 Antibody, Titration: 1.0 ug/ml, Positive Control: COLO205 Whole Cell. |
