Evx2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574317
Artikelname: Evx2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574317
Hersteller Artikelnummer: orb574317
Alternativnummer: BYT-ORB574317-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Evx2
Konjugation: Unconjugated
Rabbit polyclonal antibody to Evx2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 57kDa
NCBI: 221512
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PRLPSAPLHGALGDLPAKGKFEIDTLFNLQHPSSESTVSSEIASATESRK
Target-Kategorie: Evx2
Sample Type: Rat Kidney lysates, Antibody dilution: 1.0 ug/ml.