ZNF391 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574318
Artikelname: ZNF391 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574318
Hersteller Artikelnummer: orb574318
Alternativnummer: BYT-ORB574318-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF391
Konjugation: Unconjugated
Alternative Synonym: dJ153G14.3
Rabbit polyclonal antibody to ZNF391
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 41kDa
NCBI: 001070249
UniProt: Q9UJN7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: HTQERPYKCNECGKAFGDRSTIIQHQRIHTGENPYECSKCGKAFSWISSL
Target-Kategorie: ZNF391
WB Suggested Anti-ZNF391 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.