ZFP57 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574319
| Artikelname: |
ZFP57 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB574319 |
| Hersteller Artikelnummer: |
orb574319 |
| Alternativnummer: |
BYT-ORB574319-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZFP57 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
TNDM1, ZNF698, C6orf40, bA145L22, bA145L22.2 |
| Rabbit polyclonal antibody to ZFP57 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
49kDa |
| UniProt: |
Q9NU63 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: EDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVARIFLHKPELITK |
| Target-Kategorie: |
ZFP57 |
![]()
|
Sample Type: Lymph Node Tumor lysates, Antibody dilution: 1.0 ug/ml. |
