ZNF589 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB574320
Artikelname: ZNF589 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB574320
Hersteller Artikelnummer: orb574320
Alternativnummer: BYT-ORB574320-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF589
Konjugation: Unconjugated
Alternative Synonym: SZF1
Rabbit polyclonal antibody to ZNF589
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 39kDa
NCBI: 057173
UniProt: Q86UQ0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPYVCR
Target-Kategorie: ZNF589
Sample Type: Lung Tumor lysates, Antibody dilution: 1.0 ug/ml.