SMPDL3B Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SMPDL3B Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB574860
• Hersteller Artikelnummer: orb574860
• Alternativnummer: BYT-ORB574860-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMPDL3B
• Konjugation: Unconjugated
• Alternative Synonym: ASML3B

Produktbeschreibung

Rabbit polyclonal antibody to SMPDL3B

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 52 kDa
• NCBI: 055289
• UniProt: Q92485
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
• Target-Kategorie: SMPDL3B

Bilder

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. 52 kDa precursor is processed to 48 kDa and protein is N-link glycosylated.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): 293T (2T), Negative control (-): Human Ovary (OV), Antibody concentration: 1 ug/ml.

Human Intestine

WB Suggested Anti-SMPDL3B Antibody Titration: 0.2-1 ug/ml, Positive Control: Raji cell lysate, SMPDL3B is supported by BioGPS gene expression data to be expressed in Raji.